Structure of PDB 4yuu Chain h2

Receptor sequence
>4yuuh2 (length=62) Species: 2771 (Cyanidium caldarium) [Search protein sequence]
ALKTRLGELLRPLNSQYGKVAPGWGTTPIMGIFMALFLLFLIIILQIYNS
SLILENLDISWT
3D structure
PDB4yuu Novel Features of Eukaryotic Photosystem II Revealed by Its Crystal Structure Analysis from a Red Alga
Chainh2
Resolution2.77 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h2 T27 M31 F34 T26 M30 F33
BS02 CLA h2 F38 F41 Y49 F37 F40 Y48
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4yuu, PDBe:4yuu, PDBj:4yuu
PDBsum4yuu
PubMed26757821
UniProtO19925|PSBH_CYACA Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]