Structure of PDB 8wmw Chain h

Receptor sequence

>8wmwh (length=162) Species: 52970 (Rhodomonas salina) [Search protein sequence]

FGGRGLGVTVNAERWNGRHAMFGIFAMVMTSYMKGHGLIPDADKVLDIAQ
WGPLAAVWDGAGNGISNERAIILIAHVHVLVVSVIAAIAPFGFQDTLVKE
KGYTPESPAGLIPPFKTGLTAEAELINGRLAMLGVISIVTASLFTGTSVV
DTINLGMGKILY

3D structure

PDB

8wmw Growth phase-dependent reorganization of cryptophyte photosystem I antennae.

Chain

Resolution

3.3 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	CLA	h	W114 L117 I128 R132 L136	W51 L54 I65 R69 L73
BS02	CLA	h	V71 E76 N79 P171 G173 R192 M195	V8 E13 N16 P108 G110 R129 M132
BS03	CLA	h	L69 G70 A75 N79 H82	L6 G7 A12 N16 H19
BS04	CLA	h	W78 H82 F85 V142 L143 S146 A149 L160	W15 H19 F22 V79 L80 S83 A86 L97
BS05	CLA	h	W78 R81 M84 Q157 D158 L182 T183 E187 N190	W15 R18 M21 Q94 D95 L119 T120 E124 N127
BS06	CLA	h	F178 N190 L193	F115 N127 L130
BS07	CLA	h	L218 G219 M220 G221 I223	L155 G156 M157 G158 I160
BS08	WVN	h	M84 F85 I87 F88 L193 A194 S200	M21 F22 I24 F25 L130 A131 S137
BS09	II0	h	H82 G86 H139 V198	H19 G23 H76 V135
BS10	II0	h	I134 A138 H141 V145 F154 Q157	I71 A75 H78 V82 F91 Q94
BS11	II0	h	W114 N130 I137 H141 V144 I148 A152 P153	W51 N67 I74 H78 V81 I85 A89 P90
BS12	CLA	h	M90 R132 I135 L136 H139 V212	M27 R69 I72 L73 H76 V149

External links

PDB	RCSB:8wmw, PDBe:8wmw, PDBj:8wmw
PDBsum	8wmw
PubMed	38734819

[Back to BioLiP]