Structure of PDB 8t5h Chain h

Receptor sequence

>8t5hh (length=127) Species: 562 (Escherichia coli)

NQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLE
LVDMVEKLDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGF
VTRDARQVERKKVGLRKARRRPQFSKR

3D structure

• PDB: 8t5h How Dedicated Ribosomes Translate a Leaderless mRNA.
• Chain: h
• Resolution: 3.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	Q4 Y6 T8 R10 K12 R17 F19 R40 G68 G69 G70 S72 Q74 R84 R94 R98 T104 R105 R108 Q109 V110 E111 R112 K113 K114 V115 G116 R118 K119 R121 R122 R123 Q125 F126 K128 R129	Q2 Y4 T6 R8 K10 R15 F17 R38 G66 G67 G68 S70 Q72 R82 R92 R96 T102 R103 R106 Q107 V108 E109 R110 K111 K112 V113 G114 R116 K117 R119 R120 R121 Q123 F124 K126 R127
BS02	rna	h	K128 R129	K126 R127

External links

• PDB: RCSB:8t5h, PDBe:8t5h, PDBj:8t5h
• PDBsum: 8t5h
• PubMed: 38185325