Structure of PDB 8p2f Chain h

Receptor sequence
>8p2fh (length=148) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
PRKGSVPKRDVLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVE
QRSGRDALEVFEEAINNIMPVLEVKARRSNYQVPVEVRPERRTTLGLRWL
VNYARLRGEKTMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFA
3D structure
PDB8p2f Cryo-EM structures of Staphylococcus aureus 70S ribosomes in complex with elongation factor G and fusidic acid
Chainh
Resolution2.44 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h Q86 K143 Q82 K139
BS02 rna h P2 R3 S6 V7 R10 N28 K29 M31 D33 G34 K35 G37 T38 I42 R79 T98 K114 M116 P1 R2 S5 V6 R9 N27 K28 M30 D32 G33 K34 G36 T37 I41 R78 T94 K110 M112
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8p2f, PDBe:8p2f, PDBj:8p2f
PDBsum8p2f
PubMed38902339
UniProtP48940|RS7_STAA8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]