Structure of PDB 8ow1 Chain h |
>8ow1h (length=97) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
KARKETYSSYIYKVLKQTHPDTGISQKSMSILNSFVNDIFERIATEASKL AAYNKKSTISAREIQTAVRLILPGELAKHAVSEGTRAVTKYSSSTQA |
|
PDB | 8ow1 Cryo-EM structure of the complete inner kinetochore of the budding yeast point centromere. |
Chain | h |
Resolution | 3.7 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
h |
K90 S91 T92 |
K56 S57 T58 |
|
|
|
|