Structure of PDB 8ovj Chain h

Receptor sequence

>8ovjh (length=127) Species: 347515 (Leishmania major strain Friedlin) [Search protein sequence]

SCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGH
KRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQ
RIVKQALKEHSKMKLSHKRTANKKKSK

3D structure

PDB

8ovj Structural and mechanistic insights into the function of Leishmania ribosome lacking a single pseudouridine modification.

Chain

Resolution

2.4 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	h	R5 Q7 R9 R11 M12 H13 Y14 T16 R17 T26 G28 K38 R61 H62	R4 Q6 R8 R10 M11 H12 Y13 T15 R16 T25 G27 K37 R60 H61
BS02	rna	h	R20 M23 R25 P27 R36 S40 Q41 H44 P46 W47 H51 K52 T57 K58 R70 H71 K73 S74 V75 R77 G80 H85	R19 M22 R24 P26 R35 S39 Q40 H43 P45 W46 H50 K51 T56 K57 R69 H70 K72 S73 V74 R76 G79 H84
BS03	rna	h	S2 R5 Y8 R11 R91 R94 R102 M114 H118 R120 K124	S1 R4 Y7 R10 R90 R93 R101 M113 H117 R119 K123

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links