Structure of PDB 8iwh Chain h

Receptor sequence
>8iwhh (length=65) Species: 35128 (Thalassiosira pseudonana) [Search protein sequence]
ALRTRLGEILRPLNAEYGKVVPGWGTTPIMGLTMVLFLVFLLIILQIYNS
SLIIENVDVDWANAI
3D structure
PDB8iwh Structure of a diatom photosystem II supercomplex containing a member of Lhcx family and dimeric FCPII
Chainh
Resolution2.68 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h P29 I30 P28 I29
BS02 CLA h T27 M31 T26 M30
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8iwh, PDBe:8iwh, PDBj:8iwh
PDBsum8iwh
PubMed37878698
UniProtA0T0P8|PSBH_THAPS Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]