Structure of PDB 8esr Chain h

Receptor sequence

>8esrh (length=121) Species: 4896 (Schizosaccharomyces pombe) [Search protein sequence]

ALKTFELRKQSQENLAEQLQELRQELASLRVQKIAGGSGSKLSKIKTTRK
DIARILTVINESNRLAAREAYKNKKYIPLDLRQKKTRAIRRALTPYEQSR
KTLKQIKKERYFPLRKYALKA

3D structure

PDB

8esr Chromatin localization of nucleophosmin organizes ribosome biogenesis.

Chain

Resolution

3.2 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	L66 R69 E70 K73 K76 Y77 L82 R83 Q84 K86 R88 R92 T95 Y97 E98 R101 K102 L104 K105 I107 K108 K109 R111 Y112 F113	L65 R68 E69 K72 K75 Y76 L81 R82 Q83 K85 R87 R91 T94 Y96 E97 R100 K101 L103 K104 I106 K107 K108 R110 Y111 F112
BS02	rna	h	T5 R9 R24 G40 L43 R50 K51 A54 R55 L57 T58 N61 R65 L80 R83 Q84 K85 T87 R88 R91	T4 R8 R23 G39 L42 R49 K50 A53 R54 L56 T57 N60 R64 L79 R82 Q83 K84 T86 R87 R90

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0002181	cytoplasmic translation
GO:0006412	translation

	Cellular Component
GO:0005634	nucleus
GO:0005730	nucleolus
GO:0005737	cytoplasm
GO:0005829	cytosol
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:8esr, PDBe:8esr, PDBj:8esr
PDBsum	8esr
PubMed	36423630
UniProt	O74904\|RL35_SCHPO Large ribosomal subunit protein uL29 (Gene Name=rpl35)