Structure of PDB 8eiu Chain h

Receptor sequence
>8eiuh (length=41) Species: 562 (Escherichia coli) [Search protein sequence]
MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPATK
3D structure
PDB8eiu Rare ribosomal RNA sequences from archaea stabilize the bacterial ribosome.
Chainh
Resolution2.24 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h N11 K22 G24 Y25 N28 F29 N11 K22 G24 Y25 N28 F29
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:8eiu, PDBe:8eiu, PDBj:8eiu
PDBsum8eiu
PubMed36660825
UniProtP0A7R1|RL9_ECOLI Large ribosomal subunit protein bL9 (Gene Name=rplI)

[Back to BioLiP]