Structure of PDB 8civ Chain h

Receptor sequence

>8civh (length=258) Species: 4932 (Saccharomyces cerevisiae)

ARGPKKHLKRLAAPHHWLLDKLSGCYAPRPSAGPHKLRESLPLIVFLRNR
LKYALNGREVKAILMQRHVKVDGKVRTDTTYPAGFMDVITLDATNENFRL
VYDVKGRFAVHRITDEEASYKLGKVKKVQLGKKGVPYVVTHDGRTIRYPD
PNIKVNDTVKIDLASGKITDFIKFDAGKLVYVTGGRNLGRIGTIVHKERH
DGGFDLVHIKDSLDNTFVTRLNNVFVIGEQGKPYISLPKGKGIKLSIAEE
RDRRRAQQ

3D structure

• PDB: 8civ mRNA reading frame maintenance during eukaryotic ribosome translocation
• Chain: h
• Resolution: 2.47 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	R3 P5 K6 K7 H8 K10 R11 L12 L19 D21 K22 S24 C26 Y27 A28 P29 R30 A33 G34 K37 L38 R49 N57 G58 R59 M66 K75 R77 K106 R108 K128 L131 G132 K133 K134 G135 Y138 V140 T146 R148 G186 R187 H201 D202 G203 I248 R255	R2 P4 K5 K6 H7 K9 R10 L11 L18 D20 K21 S23 C25 Y26 A27 P28 R29 A32 G33 K36 L37 R48 N56 G57 R58 M65 K74 R76 K105 R107 K127 L130 G131 K132 K133 G134 Y137 V139 T145 R147 G185 R186 H200 D201 G202 I247 R254

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:0030686 90S preribosome
• GO:0032991 protein-containing complex
• GO:0043232 intracellular non-membrane-bounded organelle
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:8civ, PDBe:8civ, PDBj:8civ
• PDBsum: 8civ
• PubMed: 38030725
• UniProt: P0CX35|RS4A_YEAST Small ribosomal subunit protein eS4A (Gene Name=RPS4A)