Structure of PDB 7yq2 Chain h

Receptor sequence
>7yq2h (length=65) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKALG
3D structure
PDB7yq2 Crystal structures of photosystem II from a cyanobacterium expressing psbA 2 in comparison to psbA 3 reveal differences in the D1 subunit.
Chainh
Resolution1.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h F38 F41 I45 L46 Y49 F37 F40 I44 L45 Y48
BS02 CLA h T27 M31 F34 T26 M30 F33
BS03 CLA h T5 L7 G8 T4 L6 G7
BS04 RRX h M35 L37 F38 F41 M34 L36 F37 F40
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7yq2, PDBe:7yq2, PDBj:7yq2
PDBsum7yq2
PubMed36334624
UniProtQ8DJ43|PSBH_THEVB Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]