Structure of PDB 7w59 Chain h |
>7w59h (length=81) Species: 9606 (Homo sapiens) [Search protein sequence] |
IGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRD GRVAQLEQVYIRGSKIRFLILPDMLKNMLKS |
|
PDB | 7w59 Mechanism of exon ligation by human spliceosome. |
Chain | h |
Resolution | 3.6 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
rna |
h |
N40 R64 G65 S66 |
N38 R62 G63 S64 |
|
|
|
|