Structure of PDB 7v9k Chain h |
>7v9kh (length=98) Species: 9606 (Homo sapiens) [Search protein sequence] |
KKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGE ASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSA |
|
PDB | 7v9k Columnar structure of human telomeric chromatin. |
Chain | h |
Resolution | 8.1 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
dna |
h |
K24 R26 R28 R30 P47 |
K1 R3 R5 R7 P24 |
|
|
|
|