Structure of PDB 7uvx Chain h

Receptor sequence
>7uvxh (length=130) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
SMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGYISNVEV
AQEETKSTLTITLKYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLG
IAIVSTSKGIMTDRAARAAGIGGEVIAFVS
3D structure
PDB7uvx Streptothricin F is a bactericidal antibiotic effective against highly drug-resistant gram-negative bacteria that interacts with the 30S subunit of the 70S ribosome.
Chainh
Resolution2.35 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h S2 Q4 T12 R15 N16 K22 K31 K57 R81 P82 G83 Y87 K90 S106 T107 S108 S1 Q3 T11 R14 N15 K21 K30 K56 R80 P81 G82 Y86 K89 S105 T106 S107
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7uvx, PDBe:7uvx, PDBj:7uvx
PDBsum7uvx
PubMed37192172
UniProtB7IA25|RS8_ACIB5 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]