Structure of PDB 7unu Chain h

Receptor sequence
>7unuh (length=129) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
SMQDPLADMLTRIRNAQMAEKTVVSMPSSKLKAAVAKVLKDEGYIADFQI
SSEVKPQLSIELKYFEGKPVIEEVKRISRPGLRQYKSVEQLPKVRGGLGV
SIVSTNKGVMTDRAARAAGVGGEVLCTVF
3D structure
PDB7unu Compact IF2 allows initiator tRNA accommodation into the P site and gates the ribosome to elongation
Chainh
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h S2 M3 Q4 D9 T12 R13 R15 N16 M19 K22 K31 K56 R80 P81 G82 R84 Y86 S88 V89 S105 T106 N107 G120 G122 S1 M2 Q3 D8 T11 R12 R14 N15 M18 K21 K30 K55 R79 P80 G81 R83 Y85 S87 V88 S104 T105 N106 G119 G121
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7unu, PDBe:7unu, PDBj:7unu
PDBsum7unu
PubMed
UniProtQ9HWE9|RS8_PSEAE Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]