Structure of PDB 7uig Chain h |
>7uigh (length=136) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] |
GQALDAVRMRLAQLTHSLRRIRDEMSKAELPQWYTLQSQLNVTLSQLVSV TSTLQHFQETLDSTVVYPLPKFPTTSHESLVTTLLRKKNIPEVDEWMKYV RETSGEEIEKLLQQDREITNWARTTFRNEYGKHDFK |
|
PDB | 7uig Structural basis of a transcription pre-initiation complex on a divergent promoter. |
Chain | h |
Resolution | 4.3 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0000122 |
negative regulation of transcription by RNA polymerase II |
GO:0006357 |
regulation of transcription by RNA polymerase II |
GO:0032968 |
positive regulation of transcription elongation by RNA polymerase II |
GO:0045944 |
positive regulation of transcription by RNA polymerase II |
GO:0051123 |
RNA polymerase II preinitiation complex assembly |
GO:0060261 |
positive regulation of transcription initiation by RNA polymerase II |
|
|