Structure of PDB 7sfr Chain h

Receptor sequence
>7sfrh (length=130) Species: 1773 (Mycobacterium tuberculosis) [Search protein sequence]
MTDPIADFLTRLRNANSAYHDEVSLPHSKLKANIAQILKNEGYISDFRTE
DARVGKSLVIQLKYGPSRERSIAGLRRVSKPGLRVYAKSTNLPRVLGGLG
VAIISTSSGLLTDRQAARQGVGGEVLAYVW
3D structure
PDB7sfr Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
Chainh
Resolution2.6 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h M3 T4 D9 T12 R13 R15 N16 H22 S30 K31 R55 V56 K82 P83 G84 R86 Y88 K90 S91 S107 T108 S109 G111 G122 G124 M1 T2 D7 T10 R11 R13 N14 H20 S28 K29 R53 V54 K80 P81 G82 R84 Y86 K88 S89 S105 T106 S107 G109 G120 G122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7sfr, PDBe:7sfr, PDBj:7sfr
PDBsum7sfr
PubMed36827973
UniProtP9WH27|RS8_MYCTU Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]