Structure of PDB 7s0s Chain h

Receptor sequence
>7s0sh (length=48) Species: 1772 (Mycolicibacterium smegmatis) [Search protein sequence]
MKTGIHPEYVDTTVQCGCGHSFTTRSTKQSGTIVVEVCSQCHPFYTGK
3D structure
PDB7s0s 50S subunit recognition and modification by the Mycobacterium tuberculosis ribosomal RNA methyltransferase TlyA.
Chainh
Resolution3.05 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h M1 K2 H6 M1 K2 H6
BS02 ZN h E36 V37 C38 C41 E36 V37 C38 C41
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7s0s, PDBe:7s0s, PDBj:7s0s
PDBsum7s0s
PubMed35357969
UniProtA0R215|RL31_MYCS2 Large ribosomal subunit protein bL31 (Gene Name=rpmE)

[Back to BioLiP]