Structure of PDB 7qwr Chain h

Receptor sequence

>7qwrh (length=122) Species: 9986 (Oryctolagus cuniculus) [Search protein sequence]

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

PDB

7qwr Mechanism of signal sequence handover from NAC to SRP on ribosomes during ER-protein targeting.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	R70 K76 Y78 P85 R89 R93 R94 N96 K97 H98 K103 K106 R109 K110 R112	R69 K75 Y77 P84 R88 R92 R93 N95 K96 H97 K102 K105 R108 K109 R111
BS02	rna	h	A2 K3 R7 S45 K46 R48 R51 K52 A55 R56 L58 T59 N62 K66 L81 R84 K86 T88 R89 R92	A1 K2 R6 S44 K45 R47 R50 K51 A54 R55 L57 T58 N61 K65 L80 R83 K85 T87 R88 R91

Gene Ontology

	Molecular Function
GO:0003729	mRNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0000463	maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
GO:0006412	translation

	Cellular Component
GO:0005737	cytoplasm
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links

PDB	RCSB:7qwr, PDBe:7qwr, PDBj:7qwr
PDBsum	7qwr
PubMed	35201867
UniProt	G1SIT5\|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)