Structure of PDB 7pzy Chain h

Receptor sequence
>7pzyh (length=311) Species: 237561 (Candida albicans SC5314) [Search protein sequence]
QEVLVLRGTLEGHNGWVTSLATTPAHPDLLLSGSRDKTLIKWKLTGGEDN
QYGIPKKSFKGHSHIVQDVTISADGAYALSASWDRTLRLWDLETGETTQR
FVGHKGDVLSVSIAKNLRQIVSASRDKTVKVWNTIGECMATLTGHNDWVS
AVRISPSDQSSTVISASWDKTVKSWDLADYSVNADFIGHTGYISCITLSP
DGSLCASAGKDGVIILWDLNKNKTLYTLEAKAEVHALAFSPNRYWLAAAT
TSGIKIFKLQERSLLDELKPEFAVGATAKDPEAISLAWSADGQNLFAGYT
DNVIRVWQVMT
3D structure
PDB7pzy E-site drug specificity of the human pathogen Candida albicans ribosome.
Chainh
Resolution2.32 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h G64 H67 A279 T280 A281 G61 H64 A276 T277 A278
Gene Ontology
Molecular Function
GO:0001965 G-protein alpha-subunit binding
GO:0005080 protein kinase C binding
GO:0005092 GDP-dissociation inhibitor activity
GO:0030546 signaling receptor activator activity
GO:0043022 ribosome binding
GO:0045182 translation regulator activity
Biological Process
GO:0001403 invasive growth in response to glucose limitation
GO:0006412 translation
GO:0006521 regulation of cellular amino acid metabolic process
GO:0007155 cell adhesion
GO:0007186 G protein-coupled receptor signaling pathway
GO:0009267 cellular response to starvation
GO:0010508 positive regulation of autophagy
GO:0010629 negative regulation of gene expression
GO:0017148 negative regulation of translation
GO:0030447 filamentous growth
GO:0031139 positive regulation of conjugation with cellular fusion
GO:0036170 filamentous growth of a population of unicellular organisms in response to starvation
GO:0036178 filamentous growth of a population of unicellular organisms in response to neutral pH
GO:0036180 filamentous growth of a population of unicellular organisms in response to biotic stimulus
GO:0036244 cellular response to neutral pH
GO:0061157 mRNA destabilization
GO:0070651 nonfunctional rRNA decay
GO:0072344 rescue of stalled ribosome
GO:0140469 GCN2-mediated signaling
GO:1902660 negative regulation of glucose mediated signaling pathway
GO:1903138 negative regulation of cell integrity MAPK cascade
GO:1903753 negative regulation of p38MAPK cascade
GO:1990116 ribosome-associated ubiquitin-dependent protein catabolic process
GO:1990145 maintenance of translational fidelity
GO:2000765 regulation of cytoplasmic translation
GO:2001125 negative regulation of translational frameshifting
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1903561 extracellular vesicle
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pzy, PDBe:7pzy, PDBj:7pzy
PDBsum7pzy
PubMed35613268
UniProtP83774|GBLP_CANAL Small ribosomal subunit protein RACK1 (Gene Name=ASC1)

[Back to BioLiP]