Structure of PDB 7pic Chain h

Receptor sequence
>7pich (length=128) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
IAKINLLGGQAKPGPALASVGINMGEFTKQFNEKTKDKQGEMIPCVITAY
NDKSFDFILKTTPVSILLKQAAKLEKGAKNAKTIVGKITMAKAKEIAQYK
LVDLNANTVEAALKMVLGTAKQMGIEVI
3D structure
PDB7pic Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainh
Resolution9.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h A10 K11 I12 N13 K20 P21 G22 P23 M50 P52 K68 P71 V72 S73 I74 K77 K84 G85 K87 N88 A89 N113 K122 M123 G126 K129 Q130 A2 K3 I4 N5 K12 P13 G14 P15 M42 P44 K60 P63 V64 S65 I66 K69 K76 G77 K79 N80 A81 N105 K114 M115 G118 K121 Q122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pic, PDBe:7pic, PDBj:7pic
PDBsum7pic
PubMed36171285
UniProtP75550|RL11_MYCPN Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]