Structure of PDB 7pib Chain h

Receptor sequence
>7pibh (length=128) Species: 272634 (Mycoplasmoides pneumoniae M129) [Search protein sequence]
IAKINLLGGQAKPGPALASVGINMGEFTKQFNEKTKDKQGEMIPCVITAY
NDKSFDFILKTTPVSILLKQAAKLEKGAKNAKTIVGKITMAKAKEIAQYK
LVDLNANTVEAALKMVLGTAKQMGIEVI
3D structure
PDB7pib Visualizing translation dynamics at atomic detail inside a bacterial cell.
Chainh
Resolution4.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h I9 K11 I12 N13 P23 S73 K77 K84 G85 A86 K87 A89 K108 A114 K122 M123 T127 Q130 M131 I1 K3 I4 N5 P15 S65 K69 K76 G77 A78 K79 A81 K100 A106 K114 M115 T119 Q122 M123
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7pib, PDBe:7pib, PDBj:7pib
PDBsum7pib
PubMed36171285
UniProtP75550|RL11_MYCPN Large ribosomal subunit protein uL11 (Gene Name=rplK)

[Back to BioLiP]