Structure of PDB 7oui Chain h

Receptor sequence
>7ouih (length=60) Species: 3702 (Arabidopsis thaliana) [Search protein sequence]
PRSTTVGKLLKPLNSEYGKVAPGWGTTPLMGVAMALFAVFLSIILEIYNS
SVLLDGISVN
3D structure
PDB7oui High-resolution model of Arabidopsis Photosystem II reveals the structural consequences of digitonin-extraction.
Chainh
Resolution2.79 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h F50 F53 L58 F37 F40 L45
BS02 CLA h T39 M43 M47 T26 M30 M34
BS03 CLA h T17 V19 T4 V6
Gene Ontology
Molecular Function
GO:0003729 mRNA binding
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009534 chloroplast thylakoid
GO:0009535 chloroplast thylakoid membrane
GO:0009536 plastid
GO:0009579 thylakoid
GO:0009654 photosystem II oxygen evolving complex
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7oui, PDBe:7oui, PDBj:7oui
PDBsum7oui
PubMed34330992
UniProtP56780|PSBH_ARATH Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]