Structure of PDB 7ot5 Chain h

Receptor sequence

>7ot5h (length=205) Species: 562 (Escherichia coli)

ARYLGPKLKLSRREGTDLFLKSGVRAIDTKCKIEQAPGQHGARKPRLSDY
GVQLREKQKVRRIYGVLERQFRNYYKEAARLKGNTGENLLALLEGRLDNV
VYRMGFGATRAEARQLVSHKAIMVNGRVVNIASYQVSPNDVVSIREKAKK
QSRVKAALELAEQREKPTWLEVDAGKMEGTFKRKPERSDLSADINEHLIV
ELYSK

3D structure

• PDB: 7ot5 A switch from alpha-helical to beta-strand conformation during co-translational protein folding.
• Chain: h
• Resolution: 2.9 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	A2 R3 L5 P7 K8 L9 K10 R13 R14 K22 S23 R26 K31 C32 K33 G39 Q40 H41 Q54 R56 K58 Q59 R62 R63 L68 E69 R70 R81 K83 T110 E113 R115 Q116 S119 H120 R128 V130 N131 I132 S134 Y135 Q152 E202 S205 K206	A1 R2 L4 P6 K7 L8 K9 R12 R13 K21 S22 R25 K30 C31 K32 G38 Q39 H40 Q53 R55 K57 Q58 R61 R62 L67 E68 R69 R80 K82 T109 E112 R114 Q115 S118 H119 R127 V129 N130 I131 S133 Y134 Q151 E201 S204 K205
BS02	MG	h	E78 A79 A80 R81 L82	E77 A78 A79 R80 L81

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Dec 1 04:29:56 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '7ot5', asym_id = 'h', title = 'A switch from alpha-helical to beta-strand conformation during co-translational protein folding.'

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='7ot5', asym_id='h', title='A switch from alpha-helical to beta-strand conformation during co-translational protein folding.')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0003723,0003735,0006412,0015935,0019843', uniprot = '', pdbid = '7ot5', asym_id = 'h'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003723,0003735,0006412,0015935,0019843', uniprot='', pdbid='7ot5', asym_id='h')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>