Structure of PDB 7nhn Chain h

Receptor sequence
>7nhnh (length=141) Species: 169963 (Listeria monocytogenes EGD-e) [Search protein sequence]
VLPDPIYNSKLVTRLINKMMVDGKRGKSQAILYSAFDIIAQETGKDPMEV
FEQAMKNIMPLLEVKARRVGGANYQVPIEVRADRRSTLGLRWLVNYARLR
GEKTMEVRVAREIMDAANNTGASVKKREDTHKMADANRAFA
3D structure
PDB7nhn Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chainh
Resolution2.9 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h N28 K29 M30 M31 D33 G34 K38 G81 R92 R95 T98 R102 R109 K114 T115 M116 N17 K18 M19 M20 D22 G23 K27 G70 R81 R84 T87 R91 R98 K103 T104 M105
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7nhn, PDBe:7nhn, PDBj:7nhn
PDBsum7nhn
PubMed34117249
UniProtP66611|RS7_LISMO Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]