Structure of PDB 7nhl Chain h

Receptor sequence
>7nhlh (length=138) Species: 93061 (Staphylococcus aureus subsp. aureus NCTC 8325) [Search protein sequence]
VLPDPIHNSKLVTKLINKIMLDGKRGTAQRILYSAFDLVEQRSGRDALEV
FEEAINNIMPVLEVKARRSNYQVPVEVRPERRTTLGLRWLVNYARLRGEK
TMEDRLANEILDAANNTGGAVKKREDTHKMAEANKAFA
3D structure
PDB7nhl Structural basis of ABCF-mediated resistance to pleuromutilin, lincosamide, and streptogramin A antibiotics in Gram-positive pathogens.
Chainh
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#
Ligand Ligand
chain
Binding residues on receptor
(original residue number in PDB)
Binding residues on receptor
(residue number reindexed from 1)
Binding affinity
BS01 rna h N28 I30 M31 L32 D33 G34 K35 R36 T38 R41 R92 E94 R95 T98 R102 R109 K114 M116 N17 I19 M20 L21 D22 G23 K24 R25 T27 R30 R78 E80 R81 T84 R88 R95 K100 M102
Gene Ontology
Molecular Function
GO:0000049 tRNA binding
GO:0003723 RNA binding
GO:0003729 mRNA binding
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000028 ribosomal small subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0015935 small ribosomal subunit
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:7nhl, PDBe:7nhl, PDBj:7nhl
PDBsum7nhl
PubMed34117249
UniProtP48940|RS7_STAA8 Small ribosomal subunit protein uS7 (Gene Name=rpsG)

[Back to BioLiP]