Structure of PDB 7k50 Chain h

Receptor sequence
>7k50h (length=84) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAY
3D structure
PDB7k50 Structural basis for +1 ribosomal frameshifting during EF-G-catalyzed translocation.
Chainh
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h M1 L3 N4 S30 R31 G32 V33 T34 K37 M38 L41 V50 M52 V54 V55 R56 T58 L59 L60 R61 R62 E65 G78 P79 L81 M1 L3 N4 S30 R31 G32 V33 T34 K37 M38 L41 V50 M52 V54 V55 R56 T58 L59 L60 R61 R62 E65 G78 P79 L81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
Biological Process
GO:0006412 translation
Cellular Component
GO:0015934 large ribosomal subunit

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7k50, PDBe:7k50, PDBj:7k50
PDBsum7k50
PubMed34330903
UniProtP0A7J3|RL10_ECOLI Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]