Structure of PDB 7jsz Chain h

Receptor sequence
>7jszh (length=131) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
MALNLQDKQAIVAEVSEVAKGALSAVVADSRGVTVDKMTELRKAGREAGV
YMRVVRNTLLRRAVEGTPFECLKDAFVGPTLIAYSMEHPGAAARLFKEFA
KANAKFEVKAAAFEGELIPASQIDRLATLPT
3D structure
PDB7jsz ArfB can displace mRNA to rescue stalled ribosomes.
Chainh
Resolution3.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h A2 N4 D7 K8 R31 T34 K37 M38 V54 V55 R56 N57 L59 R62 E65 L81 A2 N4 D7 K8 R31 T34 K37 M38 V54 V55 R56 N57 L59 R62 E65 L81
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0019843 rRNA binding
GO:0043022 ribosome binding
GO:0070180 large ribosomal subunit rRNA binding
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
GO:0006417 regulation of translation
GO:0017148 negative regulation of translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0015934 large ribosomal subunit
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7jsz, PDBe:7jsz, PDBj:7jsz
PDBsum7jsz
PubMed33144582
UniProtP0A7J3|RL10_ECOLI Large ribosomal subunit protein uL10 (Gene Name=rplJ)

[Back to BioLiP]