Structure of PDB 7e80 Chain h |
>7e80h (length=128) Species: 99287 (Salmonella enterica subsp. enterica serovar Typhimurium str. LT2) [Search protein sequence] |
ALLNIFDIAGSALAAQSKRLNVAASNLANADSVTGPDGQPYRAKQVVFQV DAATGGVKVASVIESQAPEKLVYEPGNPLADANGYVKMPNVDVVGEMVNT MSASRSYQANIEVLNTVKSMMLKTLTLG |
|
PDB | 7e80 Structural basis of assembly and torque transmission of the bacterial flagellar motor. |
Chain | h |
Resolution | 3.67 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
peptide |
h |
V47 F49 N104 |
V46 F48 N99 |
|
|
|
|