Structure of PDB 7dxa Chain h

Receptor sequence
>7dxah (length=62) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWK
3D structure
PDB7dxa Structural insights into cyanobacterial photosystem II intermediates associated with Psb28 and Tsl0063.
Chainh
Resolution3.14 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h F38 F41 I45 L46 F37 F40 I44 L45
BS02 CLA h T27 M31 F34 L42 L43 T26 M30 F33 L41 L42
BS03 CLA h T5 L7 T4 L6
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7dxa, PDBe:7dxa, PDBj:7dxa
PDBsum7dxa
PubMed34226692
UniProtP19052|PSBH_THEVL Photosystem II reaction center protein H (Fragment) (Gene Name=psbH)

[Back to BioLiP]