Structure of PDB 7czl Chain h

Receptor sequence
>7czlh (length=62) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWK
3D structure
PDB7czl Structural insights into a dimeric Psb27-photosystem II complex from a cyanobacterium Thermosynechococcus vulcanus .
Chainh
Resolution3.78 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h I5045 L5046 Y5049 I44 L45 Y48
BS02 CLA h M5035 F5038 M34 F37
BS03 CLA h T5005 L5007 T4 L6
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7czl, PDBe:7czl, PDBj:7czl
PDBsum7czl
PubMed33495333
UniProtP19052|PSBH_THEVL Photosystem II reaction center protein H (Fragment) (Gene Name=psbH)

[Back to BioLiP]