Structure of PDB 7aqd Chain h

Receptor sequence
>7aqdh (length=93) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MKDPRDVLKRPVITERSADLMTEKKYTFEVDVRANKTEVKDAVESIFGVK
VDKVNIMNYKGKSKRVGRYTGMTSRRRKAIVKLTADSKEIEIF
3D structure
PDB7aqd Mimicry of Canonical Translation Elongation Underlies Alanine Tail Synthesis in RQC.
Chainh
Resolution3.1 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h M1 K2 T14 R16 R33 N35 K36 T37 E38 K40 K53 N55 I56 M57 N58 Y59 K60 K62 K64 V66 Y69 T70 G71 M72 S74 R75 R77 I80 K82 M1 K2 T14 R16 R33 N35 K36 T37 E38 K40 K53 N55 I56 M57 N58 Y59 K60 K62 K64 V66 Y69 T70 G71 M72 S74 R75 R77 I80 K82
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0000027 ribosomal large subunit assembly
GO:0006412 translation
Cellular Component
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:7aqd, PDBe:7aqd, PDBj:7aqd
PDBsum7aqd
PubMed33259811
UniProtP42924|RL23_BACSU Large ribosomal subunit protein uL23 (Gene Name=rplW)

[Back to BioLiP]