Structure of PDB 7acr Chain h

Receptor sequence

>7acrh (length=212) Species: 83333 (Escherichia coli K-12)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILGGMAA

3D structure

• PDB: 7acr Structures of tmRNA and SmpB as they transit through the ribosome.
• Chain: h
• Resolution: 3.44 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	G2 Q3 K4 V5 S154 R156 R169 R172 P174 L175 H176 T177 L178 R179	G1 Q2 K3 V4 S153 R155 R168 R171 P173 L174 H175 T176 L177 R178
BS02	rna	h	R72 G74 I77 G78 K79 G81 V84 E85 I101 N102 I103 K108 E110 Q123 V128 R132 K135 R136	R71 G73 I76 G77 K78 G80 V83 E84 I100 N101 I102 K107 E109 Q122 V127 R131 K134 R135
BS03	MG	h	R156 Y193 G194	R155 Y192 G193

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:7acr, PDBe:7acr, PDBj:7acr
• PDBsum: 7acr
• PubMed: 34389707
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)