Structure of PDB 6ys3 Chain h

Receptor sequence

>6ys3h (length=39) Species: 469008 (Escherichia coli BL21(DE3))

MQVILLDKVANLGSLGDQVNVKAGYARNFLVPQGKAVPA

3D structure

• PDB: 6ys3 Cryo-EM structure of the 50S ribosomal subunit at 2.58 Angstroms with modeled GBC SecM peptide
• Chain: h
• Resolution: 2.58 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	K22 G24 Y25 R27 N28 F29	K22 G24 Y25 R27 N28 F29

Gene Ontology

Molecular Function

• GO:0003735 structural constituent of ribosome
• GO:0005515 protein binding
• GO:0019843 rRNA binding
• GO:0070180 large ribosomal subunit rRNA binding

Biological Process

• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6ys3, PDBe:6ys3, PDBj:6ys3
• PDBsum: 6ys3
• UniProt: P0A7R1|RL9_ECOLI Large ribosomal subunit protein bL9 (Gene Name=rplI)