Structure of PDB 6y7c Chain h

Receptor sequence

>6y7ch (length=179) Species: 559292 (Saccharomyces cerevisiae S288C)

KFESRKIMVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTN
PKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKT
LTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRM
ARESVVSLILGSPPGKVYGNLRTVASRLK

3D structure

• PDB: 6y7c Good Vibrations: Structural Remodeling of Maturing Yeast Pre-40S Ribosomal Particles Followed by Cryo-Electron Microscopy.
• Chain: h
• Resolution: 3.8 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	T107 R110 H197 R200 I202 G203 R204 G207 K208 D209 R241 R244 E245 L252 G253 S254 P256 G257 K258 N262 R269 K271	T15 R18 H105 R108 I110 G111 R112 G115 K116 D117 R149 R152 E153 L160 G161 S162 P164 G165 K166 N170 R177 K179

Gene Ontology

Molecular Function

• GO:0003723 RNA binding
• GO:0042134 rRNA primary transcript binding
• GO:0051082 unfolded protein binding

Biological Process

• GO:0000056 ribosomal small subunit export from nucleus
• GO:0000447 endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0000472 endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0042254 ribosome biogenesis
• GO:0042255 ribosome assembly
• GO:0043248 proteasome assembly

Cellular Component

• GO:0005634 nucleus
• GO:0005730 nucleolus
• GO:0005737 cytoplasm
• GO:0030686 90S preribosome

External links

• PDB: RCSB:6y7c, PDBe:6y7c, PDBj:6y7c
• PDBsum: 6y7c
• PubMed: 32138239
• UniProt: Q99216|PNO1_YEAST Pre-rRNA-processing protein PNO1 (Gene Name=PNO1)