Structure of PDB 6v3a Chain h

Receptor sequence
>6v3ah (length=130) Species: 480119 (Acinetobacter baumannii AB0057) [Search protein sequence]
SMQDTVADMLTRVRNAQMAKKQTVSMPSSKLKVAIANVLQQEGYISNVEV
AQEETKSTLTITLKYFEGKPVIEMVKRVSRPGLRQYRGKDKLPSVKQGLG
IAIVSTSKGIMTDRAARAAGIGGEVIAFVS
3D structure
PDB6v3a Cryo-electron Microscopy Structure of the Acinetobacter baumannii 70S Ribosome and Implications for New Antibiotic Development.
Chainh
Resolution2.82 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h S2 M3 Q4 D9 T12 R13 R15 N16 K31 K57 R81 P82 G83 Y87 K90 S106 T107 S108 G123 S1 M2 Q3 D8 T11 R12 R14 N15 K30 K56 R80 P81 G82 Y86 K89 S105 T106 S107 G122
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0019843 rRNA binding
Biological Process
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022627 cytosolic small ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6v3a, PDBe:6v3a, PDBj:6v3a
PDBsum6v3a
PubMed31964740
UniProtB7IA25|RS8_ACIB5 Small ribosomal subunit protein uS8 (Gene Name=rpsH)

[Back to BioLiP]