Structure of PDB 6tnn Chain h

Receptor sequence
>6tnnh (length=120) Species: 224308 (Bacillus subtilis subsp. subtilis str. 168) [Search protein sequence]
MITKTSKNAARLKRHARVRAKLSGTAERPRLNVFRSNKHIYAQIIDDVNG
VTLASASTLDKDLNVESTGDTSAATKVGELVAKRAAEKGISDVVFDRGGY
LYHGRVKALADAAREAGLKF
3D structure
PDB6tnn Structures of B. subtilis Maturation RNases Captured on 50S Ribosome with Pre-rRNAs.
Chainh
Resolution3.07 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h R14 R17 R97 Y102 R14 R17 R97 Y102
BS02 rna h K7 R11 H15 F34 R35 S36 N37 K38 S55 H103 R105 K7 R11 H15 F34 R35 S36 N37 K38 S55 H103 R105
Gene Ontology
Molecular Function
GO:0003735 structural constituent of ribosome
GO:0008097 5S rRNA binding
GO:0019843 rRNA binding
Biological Process
GO:0006364 rRNA processing
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6tnn, PDBe:6tnn, PDBj:6tnn
PDBsum6tnn
PubMed32991829
UniProtP46899|RL18_BACSU Large ribosomal subunit protein uL18 (Gene Name=rplR)

[Back to BioLiP]