Structure of PDB 6rbd Chain h |
>6rbdh (length=181) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence] |
KFESRKIMVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTN PKFTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVKT LTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRM ARESVVSLILGSPPGKVYGNLRTVASRLKER |
|
PDB | 6rbd Conformational proofreading of distant 40S ribosomal subunit maturation events by a long-range communication mechanism. |
Chain | h |
Resolution | 3.47 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
|
|
Biological Process |
GO:0000056 |
ribosomal small subunit export from nucleus |
GO:0000447 |
endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0000472 |
endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA) |
GO:0042254 |
ribosome biogenesis |
GO:0042255 |
ribosome assembly |
GO:0043248 |
proteasome assembly |
|
|