Structure of PDB 6qt0 Chain h

Receptor sequence
>6qt0h (length=98) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence]
VKTGIAIGLNKGKKVTSMTPAPKISYKKGAASNRTKFVRSLVREIAGLSP
YERRLIDLIRNSGEKRARKVAKKRLGSFTRAKAKVEEMNNIIAASRRH
3D structure
PDB6qt0 Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
Chainh
Resolution3.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna h K4 G14 K15 V17 I26 S27 Y28 K29 K30 G31 A33 S34 R41 Y53 R55 I58 D59 R62 N63 K71 R76 L77 F80 R82 K86 K2 G12 K13 V15 I24 S25 Y26 K27 K28 G29 A31 S32 R39 Y51 R53 I56 D57 R60 N61 K69 R74 L75 F78 R80 K84
Gene Ontology
Molecular Function
GO:0003723 RNA binding
GO:0003735 structural constituent of ribosome
Biological Process
GO:0002181 cytoplasmic translation
GO:0006412 translation
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0005840 ribosome
GO:0022625 cytosolic large ribosomal subunit
GO:1990904 ribonucleoprotein complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6qt0, PDBe:6qt0, PDBj:6qt0
PDBsum6qt0
PubMed31115337
UniProtP05745|RL36A_YEAST Large ribosomal subunit protein eL36A (Gene Name=RPL36A)

[Back to BioLiP]