Structure of PDB 6q9a Chain h

Receptor sequence

>6q9ah (length=208) Species: 562 (Escherichia coli) [Search protein sequence]

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG

3D structure

PDB

6q9a How a circularized tmRNA moves through the ribosome.

Chain

Resolution

3.7 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	G2 Q3 K4 V5 R156 E161 A163 W167 R169 R172 V173 P174 H176 T177 L178 R179 E188 T192 Y193 V195 K199	G1 Q2 K3 V4 R155 E160 A162 W166 R168 R171 V172 P173 H175 T176 L177 R178 E187 T191 Y192 V194 K198
BS02	rna	h	R72 I77 K80 G81 V84 E85 Q100 N102 R126 R127 V128 R131 R132 R143 I162	R71 I76 K79 G80 V83 E84 Q99 N101 R125 R126 V127 R130 R131 R142 I161

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:6q9a, PDBe:6q9a, PDBj:6q9a
PDBsum	6q9a
PubMed	30765567
UniProt	P0A7V3\|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)

[Back to BioLiP]