Structure of PDB 6q98 Chain h

Receptor sequence

>6q98h (length=208) Species: 562 (Escherichia coli)

GQKVHPNGIRLGIVKPWNSTWFANTKEFADNLDSDFKVRQYLTKELAKAS
VSRIVIERPAKSIRVTIHTARPGIVIGKKGEDVEKLRKVVADIAGVPAQI
NIAEVRKPELDAKLVADSITSQLERRVMFRRAMKRAVQNAMRLGAKGIKV
EVSGRLGGAEIARTEWYREGRVPLHTLRADIDYNTSEAHTTYGVIGVKVW
IFKGEILG

3D structure

• PDB: 6q98 How a circularized tmRNA moves through the ribosome.
• Chain: h
• Resolution: 4.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	G2 Q3 K4 I14 K27 R127 S154 G155 R156 W167 R169 G171 R172 V173 P174 L175 H176 T177 L178 R179 T192 Y193 G194 V195 K199	G1 Q2 K3 I13 K26 R126 S153 G154 R155 W166 R168 G170 R171 V172 P173 L174 H175 T176 L177 R178 T191 Y192 G193 V194 K198
BS02	rna	h	R72 G74 I77 G78 K79 K80 G81 E82 D83 V84 Q100 I101 I103 R132 K135 R136 Q139 R143 I162	R71 G73 I76 G77 K78 K79 G80 E81 D82 V83 Q99 I100 I102 R131 K134 R135 Q138 R142 I161

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome
• GO:0019843 rRNA binding

Biological Process

• GO:0000028 ribosomal small subunit assembly
• GO:0002181 cytoplasmic translation
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005840 ribosome
• GO:0022627 cytosolic small ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:6q98, PDBe:6q98, PDBj:6q98
• PDBsum: 6q98
• PubMed: 30765567
• UniProt: P0A7V3|RS3_ECOLI Small ribosomal subunit protein uS3 (Gene Name=rpsC)