Structure of PDB 6pfy Chain h

Receptor sequence

>6pfyh (length=151) Species: 197221 (Thermosynechococcus vestitus BP-1) [Search protein sequence]

LVKPYNGDPFVGHLSTPISDSGLVKTFIGNLPAYRQGLSPILRGLEVGMA
HGYFLIGPWVKLGPLRDSDVANLGGLISGIALILVATACLAAYGLVSFQK
GGSSSDPLKTSEGWSQFTAGFFVGAMGSAFVAFFLLENFLVVDGIMTGLF
N

3D structure

PDB

6pfy Membrane protein megahertz crystallography at the European XFEL.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CLA	h	Y56 L138 I148	Y53 L135 I145
BS02	CLA	h	V5 T19 P20	V2 T16 P17
BS03	CLA	h	P61 W62 L65 R69	P58 W59 L62 R66
BS04	CLA	h	W62 P67 I80 S81	W59 P64 I77 S78
BS05	CLA	h	L85 Y96	L82 Y93
BS06	CA	h	F153 N154	F150 N151
BS07	CLA	h	T90 A91 A94	T87 A88 A91
BS08	CLA	h	H16 T19 I21 S22 V27	H13 T16 I18 S19 V24
BS09	CA	h	P67 D70	P64 D67
BS10	CLA	h	F30 N33 R38 E49 M52	F27 N30 R35 E46 M49
BS11	CLA	h	P35 A36 V50 H54 F57	P32 A33 V47 H51 F54
BS12	CLA	h	Y56 F57 G60 P61 L139	Y53 F54 G57 P58 L136

Gene Ontology

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009522	photosystem I
GO:0009538	photosystem I reaction center
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:6pfy, PDBe:6pfy, PDBj:6pfy
PDBsum	6pfy
PubMed	31685819
UniProt	Q8DGB4\|PSAL_THEVB Photosystem I reaction center subunit XI (Gene Name=psaL)

[Back to BioLiP]