Structure of PDB 6kac Chain h

Receptor sequence
>6kach (length=68) Species: 3055 (Chlamydomonas reinhardtii) [Search protein sequence]
EPGLVTPLGTLLRPLNSEAGKVLPGWGTTVLMAVFILLFAAFLLIILEIY
NSSLILDDVSMSWETLAK
3D structure
PDB6kac Structural insight into light harvesting for photosystem II in green algae.
Chainh
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h F60 I63 F42 I45
BS02 CLA h F60 I64 L65 Y68 F42 I46 L47 Y50
BS03 CLA h T46 L49 M50 F53 T28 L31 M32 F35
BS04 CLA h L26 L30 L8 L12
BS05 CLA h T24 L26 T6 L8
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009507 chloroplast
GO:0009523 photosystem II
GO:0009535 chloroplast thylakoid membrane
GO:0009579 thylakoid
GO:0016020 membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6kac, PDBe:6kac, PDBj:6kac
PDBsum6kac
PubMed31768031
UniProtP22666|PSBH_CHLRE Photosystem II reaction center protein H (Gene Name=psbH)

[Back to BioLiP]