Structure of PDB 6jln Chain h

Receptor sequence
>6jlnh (length=65) Species: 32053 (Thermostichus vulcanus) [Search protein sequence]
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNS
TLILDGVNVSWKALG
3D structure
PDB6jln An oxyl/oxo mechanism for oxygen-oxygen coupling in PSII revealed by an x-ray free-electron laser.
Chainh
Resolution2.4 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h F41 I45 Y49 F40 I44 Y48
BS02 CLA h T27 M31 F34 T26 M30 F33
BS03 CLA h L14 N15 L13 N14
BS04 CLA h T5 L7 G8 T4 L6 G7
BS05 CLA h V33 G36 L37 V32 G35 L36
Gene Ontology
Molecular Function
GO:0042301 phosphate ion binding
Biological Process
GO:0015979 photosynthesis
GO:0050821 protein stabilization
Cellular Component
GO:0009523 photosystem II
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:6jln, PDBe:6jln, PDBj:6jln
PDBsum6jln
PubMed31624207
UniProtP19052|PSBH_THEVL Photosystem II reaction center protein H (Fragment) (Gene Name=psbH)

[Back to BioLiP]