Structure of PDB 5t2a Chain h

Receptor sequence

>5t2ah (length=124) Species: 5661 (Leishmania donovani) [Search protein sequence]

SCPRVQYRRRMHYATRGNRMKMVRTPGNKLVMQKRAKRSQGIHTPWVLGH
KRLGGTKALRHIDARLASRHEKSVSRAYGGVLSHDQVRDRVVRAFLVEEQ
RIVKQALKEHSKMKLSHKRTANKK

3D structure

PDB

5t2a Structures and stabilization of kinetoplastid-specific split rRNAs revealed by comparing leishmanial and human ribosomes.

Chain

Resolution

2.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	rna	h	C3 R5 Q7 R9 R11 M12 H13 Y14 T16 R17 T26 G28 Q34 K38 R61 R66	C2 R4 Q6 R8 R10 M11 H12 Y13 T15 R16 T25 G27 Q33 K37 R60 R65
BS02	rna	h	C3 R5 V6 Y8 H13 Y14 R91 R94 A95 R102 K105 K109	C2 R4 V5 Y7 H12 Y13 R90 R93 A94 R101 K104 K108
BS03	rna	h	C3 R17 R20 M23 R25 P27 N29 R36 K38 R39 S40 Q41 G42 H44 P46 W47 H51 R53 G55 G56 A59 H62 R66 H71 K73 V75 S76 R77 Y79 G81 H85	C2 R16 R19 M22 R24 P26 N28 R35 K37 R38 S39 Q40 G41 H43 P45 W46 H50 R52 G54 G55 A58 H61 R65 H70 K72 V74 S75 R76 Y78 G80 H84

Gene Ontology

	Molecular Function
GO:0003735	structural constituent of ribosome

	Biological Process
GO:0006412	translation
GO:0042254	ribosome biogenesis

	Cellular Component
GO:0005840	ribosome
GO:0022625	cytosolic large ribosomal subunit
GO:1990904	ribonucleoprotein complex

External links