Structure of PDB 5oy0 Chain h

Receptor sequence
>5oy0h (length=38) Species: 1148 (Synechocystis sp. PCC 6803) [Search protein sequence]
MDGSYAASYLPWILIPMVGWLFPAVTMGLLFIHIESEG
3D structure
PDB5oy0 Structure and function of wild-type and subunit-depleted photosystem I in Synechocystis.
Chainh
Resolution2.501 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CLA h L21 V25 L21 V25
BS02 CLA h M17 V18 M17 V18
BS03 CLA h P11 L14 I15 V18 P11 L14 I15 V18
BS04 CLA h V18 F22 V18 F22
Gene Ontology
Cellular Component
GO:0009522 photosystem I
GO:0009579 thylakoid
GO:0016020 membrane
GO:0031676 plasma membrane-derived thylakoid membrane
GO:0042651 thylakoid membrane

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:5oy0, PDBe:5oy0, PDBj:5oy0
PDBsum5oy0
PubMed29414678
UniProtQ55330|PSAI_SYNY3 Photosystem I reaction center subunit VIII (Gene Name=psaI)

[Back to BioLiP]