Structure of PDB 5osg Chain h

Receptor sequence

>5osgh (length=173) Species: 5661 (Leishmania donovani) [Search protein sequence]

NGVYVKNWGTGSVADATNVFSAAGKVVKVQLRRQRYALVFFENSAAVKKA
IDLFNEKEVLGQTVLVVPAKASPKPDAHENSSCVFVSPIFRPSTTKAQVM
ELFAGVKVQRLRMYRQNFAYAYLDSPAAAKKFVEEKNGTAFRGHTLRVAL
SARSLEKLRARQEVANVVIAAHR

3D structure

PDB

5osg The cryo-EM Structure of a Novel 40S Kinetoplastid-Specific Ribosomal Protein.

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	N55 Y58 R87 F94 S98 A100 V101 K102 I105 P122 A123 K124 D130 F139 R145 P146 S147 T149 K150 Q152 R164 R166 M167 Y168 R169 Q170 N171 F172 R196 H198 R201 S205 A206 R207 K211 L212 R215 Q216 V222 I223	N1 Y4 R33 F40 S44 A46 V47 K48 I51 P68 A69 K70 D76 F85 R91 P92 S93 T95 K96 Q98 R110 R112 M113 Y114 R115 Q116 N117 F118 R142 H144 R147 S151 A152 R153 K157 L158 R161 Q162 V168 I169

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5osg, PDBe:5osg, PDBj:5osg
PDBsum	5osg
PubMed	29107485
UniProt	A0A3Q8IT45

[Back to BioLiP]