Structure of PDB 5opt Chain h

Receptor sequence

>5opth (length=173) Species: 353153 (Trypanosoma cruzi strain CL Brener) [Search protein sequence]

NGLYVKNWGQGSVDDARALFGTAGKVVGVRVRRRRYAIIFFENAAAVKKA
IDLFNGKEFMGNVLSVVPAKTTPKPDPHANSSVVFVSPIFRASTTKKQIL
ELFSGMKVLRLRTYRNNYAYVYLDTPAAAQRAVKEKNGAEFRGKQLRVAL
STRSLAKDRARAERARLLMAAQK

3D structure

PDB

5opt The cryo-EM Structure of a Novel 40S Kinetoplastid-Specific Ribosomal Protein.

Chain

Resolution

4.0 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	G69 Y71 R99 I105 F107 E109 V114 K115 I118 A136 K137 T138 F152 F157 R158 A159 S160 K174 R177 R179 T180 Y181 R182 N183 G210 S218 K224 A229 M236	G2 Y4 R32 I38 F40 E42 V47 K48 I51 A69 K70 T71 F85 F90 R91 A92 S93 K107 R110 R112 T113 Y114 R115 N116 G143 S151 K157 A162 M169

Gene Ontology

	Molecular Function
GO:0003676	nucleic acid binding
GO:0003723	RNA binding
GO:0003729	mRNA binding

	Cellular Component
GO:0005634	nucleus
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Cellular Component

External links

PDB	RCSB:5opt, PDBe:5opt, PDBj:5opt
PDBsum	5opt
PubMed	29107485
UniProt	Q4DY32

[Back to BioLiP]