Structure of PDB 5lzs Chain h

Receptor sequence

>5lzsh (length=122) Species: 9986 (Oryctolagus cuniculus)

AKIKARDLRGKKKEELLKQLDDLKVELSQLRVAKVTGGAASKLSKIRVVR
KSIARVLTVINQTQKENLRKFYKGKKYKPLDLRPKKTRAMRRRLNKHEES
LKTKKQQRKERLYPLRKYAVKA

3D structure

• PDB: 5lzs Decoding Mammalian Ribosome-mRNA States by Translational GTPase Complexes.
• Chain: h
• Resolution: 3.31 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	R70 K76 Y78 K79 R84 P85 R93 R94 N96 K97 H98 S101 K105 K106 K110 R112	R69 K75 Y77 K78 R83 P84 R92 R93 N95 K96 H97 S100 K104 K105 K109 R111
BS02	rna	h	K5 A6 R10 S42 S45 I47 R48 R51 K52 R56 L58 T59 N62 Q63 K66 L81 R84 P85 K86 T88 R89 R92	K4 A5 R9 S41 S44 I46 R47 R50 K51 R55 L57 T58 N61 Q62 K65 L80 R83 P84 K85 T87 R88 R91

Gene Ontology

Molecular Function

• GO:0003729 mRNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0000463 maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)
• GO:0006412 translation

Cellular Component

• GO:0005737 cytoplasm
• GO:0005840 ribosome
• GO:0022625 cytosolic large ribosomal subunit
• GO:1990904 ribonucleoprotein complex

External links

• PDB: RCSB:5lzs, PDBe:5lzs, PDBj:5lzs
• PDBsum: 5lzs
• PubMed: 27863242
• UniProt: G1SIT5|RL35_RABIT Large ribosomal subunit protein uL29 (Gene Name=RPL35)