Structure of PDB 5gm6 Chain h

Receptor sequence

>5gm6h (length=70) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

PVNPKPFLKGLVNHRVGVKLKSTEYRGTLVSTDNYFNLQLNEAEEFVAGV
SHGTLGEIFIRCNNVLYIRE

3D structure

PDB

5gm6 Structure of a yeast activated spliceosome at 3.5 angstrom resolution

Chain

Resolution

3.5 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	h	K32 N47 Y48 N76	K21 N34 Y35 N63

Gene Ontology

	Biological Process
GO:0000245	spliceosomal complex assembly
GO:0000387	spliceosomal snRNP assembly
GO:0000395	mRNA 5'-splice site recognition
GO:0000398	mRNA splicing, via spliceosome
GO:0006397	mRNA processing
GO:0008380	RNA splicing
GO:0036261	7-methylguanosine cap hypermethylation
GO:1903241	U2-type prespliceosome assembly

	Cellular Component
GO:0000243	commitment complex
GO:0005634	nucleus
GO:0005681	spliceosomal complex
GO:0005682	U5 snRNP
GO:0005685	U1 snRNP
GO:0005686	U2 snRNP
GO:0005687	U4 snRNP
GO:0005737	cytoplasm
GO:0034715	pICln-Sm protein complex
GO:0046540	U4/U6 x U5 tri-snRNP complex
GO:0071001	U4/U6 snRNP
GO:0071013	catalytic step 2 spliceosome
GO:0120114	Sm-like protein family complex

External links

PDB	RCSB:5gm6, PDBe:5gm6, PDBj:5gm6
PDBsum	5gm6
PubMed	27445306
UniProt	P54999\|RUXF_YEAST Small nuclear ribonucleoprotein F (Gene Name=SMX3)